PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g014130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 747aa    MW: 84188.9 Da    PI: 4.0108
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g014130.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat+ gyWk+tgkd+e+ 
  Csa19g014130.1   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTGKDREIR 102
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Csa19g014130.1 103 N-GSKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                     9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-607160IPR003441NAC domain
PROSITE profilePS5100558.3249160IPR003441NAC domain
PfamPF023652.1E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MGGGSATSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYGNG SKTNRATEMG YWKTTGKDRE IRNGSKVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDEE LDKINVHQQD AYVLCRIFQK SGSGPKNGEQ YGAPFVEEEW  180
EEEDDIITFV PDPYLASEDH VYVHMDDIDQ KPDNLVVYDA IPLPLNFNHG ESSNNAETNY  240
SDSINYIQPG NYVDSGGYFD KPEESSEKDQ KPIIHDGDLH IDALFQDDEI GCGVQDEHTA  300
NLQSSGNIFG TDLSCYNDFP AESNYLTGGE FQDPNSNVLQ NDGLYLETND LSSTQQDGFN  360
FEDYLTIFDE DDENAQYLTF DPSQLMGDED VFVDQEELFQ EKPDNLVVYD AIPLPLNFNH  420
GESSNNAETN YSDSINYIQP GNYVDSGGYF DKPEESSEKD QKPIIHDGDL HIDALFQDDE  480
IGCGVQDEHT ANLQSSGNIF GTDLSCYNDF PAESNYLTGG EFQDPNSNVL QNDGLYLETN  540
DLSSTQQDGF NFEDYLTIFD EDDENAQYLT FDPSQLMGDE DVFVDQEELF QEVDKEETTG  600
DKQVVEEKEK DEASCSKQVD ADATEFEPDY KYPFLKKASH MLGAIPAPPA FASEFPTKAA  660
AIRLNAGQSS GSVHVTAGMI TISDSNMGWS YDKIANRELI LSYRLVQENA SGKLGNSLTR  720
AMLIFMCFWV LLLSVSFKVS TLVTSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-44816619174NAC domain-containing protein 19
3swm_B1e-44816619174NAC domain-containing protein 19
3swm_C1e-44816619174NAC domain-containing protein 19
3swm_D1e-44816619174NAC domain-containing protein 19
3swp_A1e-44816619174NAC domain-containing protein 19
3swp_B1e-44816619174NAC domain-containing protein 19
3swp_C1e-44816619174NAC domain-containing protein 19
3swp_D1e-44816619174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010486664.10.0PREDICTED: NAC domain-containing protein 78
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLR0HKM10.0R0HKM1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1085__AT3G10500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53